PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010736
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family LBD
Protein Properties Length: 234aa    MW: 26139.4 Da    PI: 9.202
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58678012PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260108.35.7e-3436132197
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                aCa+C+++r+kC+++C+lap fpae++++f++vhk+FG+snv+kl+k+l +e+ ++a++sl++eA++r++dPv G +g +++++++l+  k++ +++
  Lsa010736  36 ACASCRHQRKKCTEKCILAPFFPAEKTQDFQAVHKVFGVSNVTKLVKDLTREDGKKAVDSLIWEANCRLKDPVLGPLGEFQRVSEELRVYKTQYQQA 132
                7**************************************************************************************9999887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.49835136IPR004883Lateral organ boundaries, LOB
PfamPF031954.7E-3336132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MQKSHITTTT IRVLEAAPSP SPPPTTTTNG GGGVPACASC RHQRKKCTEK CILAPFFPAE  60
KTQDFQAVHK VFGVSNVTKL VKDLTREDGK KAVDSLIWEA NCRLKDPVLG PLGEFQRVSE  120
ELRVYKTQYQ QANIHHHHLR QIPITQNGVL YNNKSGQQRL IGSWNGDNNG INNGAVLDYI  180
HSNGIGNGGG IDNSRMFNYG SLQNMEKLKQ ERDQQQGSLI HPQQHMMNDF SQFY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016541258.11e-59PREDICTED: LOB domain-containing protein 2
TrEMBLA0A103XV331e-135A0A103XV33_CYNCS; Lateral organ boundaries domain-containing protein
STRINGSolyc12g010810.1.14e-56(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-40LOB domain-containing protein 2